PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr035386.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 800aa    MW: 87503.4 Da    PI: 6.8862
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr035386.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS330.23.8e-1014357982374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                   ++L+++Ae v +g+++ aq +Larl+++ sp g+p+qR+a+yf+eAL+  l+ + + +  + pp++ ++ + + ++ a+k+fsevsP+l+f ++t+N
  Pbr035386.1 435 LDQLYKAAELVGTGNFSHAQGILARLNHQLSPVGKPLQRAAFYFKEALQLLLLMNNPAT--SPPPRTPTPFDIIFKMGAYKVFSEVSPLLQFVNFTCN 530
                  679**************************************************955554..57888899999************************** PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl..elee 193
                  qa+lea++  +++Hi+Dfdi+ G++W++++q+L  R+  +++pslRiT++ sp++++  el+ ++++L++fA+e+g++f+ +v+  ++l++   +l  
  Pbr035386.1 531 QALLEALSDTDQIHIVDFDIGFGAHWASFMQELPIRNrgASAPSLRITAFTSPSTHHPVELRLMRDNLTQFANEIGISFDLEVVNIDSLDQNsySLPI 628
                  **********************************99966779*****************************************988877766224556 PP

         GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellg 291
                  +r +++Ea+aVn+ +   ++ +++++l++    vL++vk+lsPk+vv  ++ +d+++ +F +++l+al+ y  l++sl+a    +s++ +k+Er+ll+
  Pbr035386.1 629 FRANNNEAVAVNFPI--WSTSNQPAALPN----VLRFVKQLSPKIVVSLDRGCDRSDLPFPQHILQALQSYINLLESLDAV-NVTSDAVNKIERFLLQ 719
                  78888********99..666678999999....*********************************************665.579************* PP

         GRAS 292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ++i++ v  + +       ++  W+  + +aGF+pvp+s+++++qa++++++ + +g++ve++++slvl+W++r+L+s+SaWr
  Pbr035386.1 720 PKIESTVLGRLRT----PDKMPLWKTLFASAGFTPVPFSNFTETQAECVVKRNPARGFHVEKRQESLVLCWQRRELISASAWR 798
                  *******998887....9999*************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.214408778IPR005202Transcription factor GRAS
PfamPF035141.3E-98435798IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 800 aa     Download sequence    Send to blast
MPFQFQQGKG VIEIATASLP AIFTDSSCSK YKDGGFFNHH HHSFPTSEPN SVLHMRRSPS  60
PPTSASTLSS SFNNGGGGGD KSTPLAAETP PAVGPTSSKD EWACELQSIP SGGLEAVTGS  120
AGGVQRCGLG LGGLEDWETM LSETAASPGH DQSLLRWIAG DVDDTSFGLK QLLQSGNNHH  180
HHHNSPLDFD GNAGLGVVDQ GPNFDLIGNG GVSDPNFGFG GSGFGNGSNK GSNGKLGFVP  240
PGSGSFGLLN YKVSNVESMH NNGGSNSVNC NIQNPIFSNS SNTLALPVSL PAVYGQQQLS  300
PDEKPQILNP QLFMSNQNQQ PQVAQNPNFF MPLAYAQQEQ HHLLQSQPKR HNSGTNIDPS  360
THQIQKGQFS DPGQEFFMRK QQQQQFGFAQ GMQFLPQQHR IQQKPLMVPK QKVVLGNGEE  420
MAHHQQQQQL QHTLLDQLYK AAELVGTGNF SHAQGILARL NHQLSPVGKP LQRAAFYFKE  480
ALQLLLLMNN PATSPPPRTP TPFDIIFKMG AYKVFSEVSP LLQFVNFTCN QALLEALSDT  540
DQIHIVDFDI GFGAHWASFM QELPIRNRGA SAPSLRITAF TSPSTHHPVE LRLMRDNLTQ  600
FANEIGISFD LEVVNIDSLD QNSYSLPIFR ANNNEAVAVN FPIWSTSNQP AALPNVLRFV  660
KQLSPKIVVS LDRGCDRSDL PFPQHILQAL QSYINLLESL DAVNVTSDAV NKIERFLLQP  720
KIESTVLGRL RTPDKMPLWK TLFASAGFTP VPFSNFTETQ AECVVKRNPA RGFHVEKRQE  780
SLVLCWQRRE LISASAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3145379822375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009343059.10.0PREDICTED: scarecrow-like protein 22
TrEMBLM5WE330.0M5WE33_PRUPE; Uncharacterized protein
STRINGPOPTR_0003s11020.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132692130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-119GRAS family protein